KHDRBS1 Rabbit Polyclonal Antibody

SKU: orb576217

Description

Rabbit polyclonal antibody to KHDRBS1

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse KHDRBS1
• Target: KHDRBS1
• Protein Sequence: Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG
• Molecular Weight: 49kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

p6, Sam, p62, p68, Sam68

WB Suggested Anti-KHDRBS1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.

Quick Database Links

Gene Symbol

KHDRBS1

UniProt

Q60749

RefSeq (Protein):NP_035447