KDSR Rabbit Polyclonal Antibody

• Catalog Number: orb579411
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KDSR
• Target: KDSR
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human KDSR
• Protein Sequence: Synthetic peptide located within the following region: KKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCA
• UniProt ID: B4DMX0
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: DHSR, FVT1, EKVP4, SDR35C1
• Note: For research use only
• NCBI: NP_002026.1

Sample Type: PANC1 Whole cell lysates, Antibody Dilution: 1.0 ug/ml.