Kctd3 Rabbit Polyclonal Antibody

• Catalog Number: orb575421
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Kctd3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Reactivity: Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 89kDa
• Target: Kctd3
• UniProt ID: Q8BFX3
• Protein Sequence: Synthetic peptide located within the following region: MKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVSGNWIEIAYGTSSGAVR
• NCBI: NP_766238
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NY-REN, NY-REN-45, 9330185B06, 4930438A20Rik, E330
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Kctd3 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Liver.