Kcnq3 Rabbit Polyclonal Antibody

• Catalog Number: orb329812
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Kcnq3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Hamster, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 97kDa
• Target: Kcnq3
• UniProt ID: Q8K3F6
• Protein Sequence: Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ
• NCBI: NP_690887
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: 100 ug CHO cell lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:25000, Gene Name: Kcnq3.

WB Suggested Anti-Kcnq3 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Heart.