KCNK13 Rabbit Polyclonal Antibody

SKU: orb575452

Description

Rabbit polyclonal antibody to KCNK13

Research Area

Cell Biology, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Equine, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK13
• Target: KCNK13
• Protein Sequence: Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
• Molecular Weight: 45kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

THIK1, THIK-1, K2p13.1

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. KCNK13 is supported by BioGPS gene expression data to be expressed in 721_B.

Rabbit Anti-Q9HB14 Antibody, Paraffin Embedded Tissue: Human Brain, Cellular Data: Neural Cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Application: IHC, Species + Tissue/Cell type: MDCK Cells, Primary antibody dilution: 1:100, Secondary antibody: Anti-rabbit-Alexa488, Secondary antibody dilution: 1:1000.

WB Suggested Anti-KCNK13 Antibody Titration: 0.12 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

KCNK13

UniProt

Q9HB14

RefSeq (Protein):NP_071337