You have no items in your shopping cart.
Cart summary
Item 1 of 1
KCNJ4 Rabbit Polyclonal Antibody
Catalog Number: orb575393
| Catalog Number | orb575393 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KCNJ4 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Canine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human KCNJ4 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 49kDa |
| Target | KCNJ4 |
| UniProt ID | P48050 |
| Protein Sequence | Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI |
| NCBI | NP_004972 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | HIR, HRK1, IRK3, HIRK2, IRK-3, Kir2.3 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-KCNJ4 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, KCNJ4 is supported by BioGPS gene expression data to be expressed in HEK293T.
- Item 1 of 3
- Item 1 of 1
Anti-Kir2.3 Antibody [orb515566]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 200 μl, 100 μl - Item 1 of 1
- Item 1 of 1
KCNJ4 Antibody [orb128252]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 200 μg, 50 μg, 25 μg - Item 1 of 1
