Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Kcnip3 Rabbit Polyclonal Antibody

SKU: orb574294

Description

Kcnip3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Kcnip3. It is suitable for WB and is reactive with mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityMouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetKcnip3
Protein SequenceSynthetic peptide located within the following region: PMSMEDSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECP
Molecular Weight26kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Cs, DRE, Csen, KChI, DREAM, R7484, KChIP3, R74849, AI413860, 4933407H12Rik

Similar Products

  • CSEN Rabbit Polyclonal Antibody [orb1190]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • KChIP3 Antibody (N-term M1) [orb1935246]

    IF,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • DREAM (phospho Ser63) rabbit pAb Antibody [orb768609]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • DREAM rabbit pAb Antibody [orb765075]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CSEN Rabbit Polyclonal Antibody [orb573970]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry