Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

KCNIP2 Rabbit Polyclonal Antibody

SKU: orb575512

Description

KCNIP2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KCNIP2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Molecular Biology, Neuroscience, Pharmacology & Drug Discovery

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP2
TargetKCNIP2
Protein SequenceSynthetic peptide located within the following region: ALAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKE
Molecular Weight32kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

KCHIP2

Similar Products

  • KChIP2/KCNIP2 Rabbit Polyclonal Antibody [orb315160]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • KCNIP2 Rabbit Polyclonal Antibody [orb575514]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • KCNIP2 Rabbit Polyclonal Antibody [orb575509]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • KCNIP2 Antibody (N-term) [orb166194]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • KCNIP2 Rabbit Polyclonal Antibody [orb575515]

    WB

    Canine, Rabbit

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KCNIP2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

KCNIP2 Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat.

KCNIP2 Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug HEK-293 cell lysate, Lane 2: 20 ug mkchIP2-YFP transfected HEK-293 lysate, Lane 3: 20 ug mkchIP3-YFP transfected HEK-293 lysate, Lane 4: 20 ug mkchIP4-YFP transfected HEK-293 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Donkey anti-rabbit-HRP, Secondary Antibody dilution: 1:10000, Gene Name: KCNIP2.

KCNIP2 Rabbit Polyclonal Antibody

Rabbit Anti-KCNIP2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

KCNIP2 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, KCNIP2 is supported by BioGPS gene expression data to be expressed in Jurkat.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055406

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

KCNIP2 Rabbit Polyclonal Antibody (orb575512)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry