KCNH6 Rabbit Polyclonal Antibody

• Catalog Number: orb575458
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNH6
• Target: KCNH6
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNH6
• Protein Sequence: Synthetic peptide located within the following region: PRMPHLAVATDKTLAPSSEQEQPEGLWPPLASPLHPLEVQGLICGPCFSS
• UniProt ID: Q9H252
• MW: 110 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ERG2, ERG-2, HERG2, Kv11.2, hERG-2
• Research Area: Cardiovascular Research, Cell Biology, Epigenetics
• Note: For research use only
• NCBI: NP_775115

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is contained in several isoforms from 110 kDa to 92 kDa and the protein may be glycosylated.

WB Suggested Anti-KCNH6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.