KCNA2 Rabbit Polyclonal Antibody

• Catalog Number: orb588628
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNA2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 54 kDa
• Target: KCNA2
• UniProt ID: P16389
• Protein Sequence: Synthetic peptide located within the following region: AAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGD
• NCBI: NP_004965.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HK4, MK2, HBK5, NGK1, RBK2, DEE32, HUKIV, KV1.2, E
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-KCNA2 antibody Titration: 1 ug/ml, Sample Type: Human MCF7 Whole Cell.