KCNA10 Rabbit Polyclonal Antibody

SKU: orb575397

Description

Rabbit polyclonal antibody to KCNA10

Research Area

Cardiovascular Research, Cell Biology, Pharmacology & Drug Discovery

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNA10
• Target: KCNA10
• Protein Sequence: Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
• Molecular Weight: 58kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Kcn1, Kv1.8

Anti-KCNA10 antibody IHC of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. KCNA10 Antibody orb575397 concentration 5 ug/ml.

WB Suggested Anti-KCNA10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

KCNA10

UniProt

Q16322

RefSeq (Protein):NP_005540