KIAA1267 Rabbit Polyclonal Antibody

SKU: orb325972

Description

Rabbit polyclonal antibody to KANSL1

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: KANSL1
• Protein Sequence: Synthetic peptide located within the following region: QPVLEFSLENLRTMNTSGQTALPQAPVNGLAKKLTKSSTHSDHDNSTSLN
• Molecular Weight: 121kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686P06109 antibody, anti DKFZp727C091 antibody, anti MGC102843 antibody, anti NSL1 antibody, anti MSL1v1 antibody, anti CENP-36 antibody, anti KIAA1267 antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.

WB Suggested Anti-KIAA1267 Antibody, Titration: 1.0 ug/mL, Positive Control: ACHN Whole Cell.

Quick Database Links

Gene Symbol

KANSL1

UniProt

Q7Z3B3

RefSeq (Protein):NP_056258