You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977175 |
---|---|
Category | Proteins |
Description | Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli. |
Tag | N-6xHis |
Purity | 98.00% |
Protein Sequence | ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD |
UniProt ID | Q61955 |
MW | 29.1 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Mouse |
Biological Activity | Kallikrein 8 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli. |
Expression Region | 33-260 aa |
Storage | -20°C |
Note | For research use only |