You have no items in your shopping cart.
Cart summary
K99 fimbrial Protein, E. coli, Recombinant
Catalog Number: orb1979270
| Catalog Number | orb1979270 |
|---|---|
| Category | Proteins |
| Description | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae. |
| Tag | Tag Free |
| Purity | 98.00% |
| MW | 16.5 kDa (predicted) |
| UniProt ID | P18103 |
| Protein Sequence | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae. |
| Expression Region | 23-181 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
E. coli FANC protein [orb418884]
Greater than 90% as determined by SDS-PAGE.
16.5 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
E. coli FANC protein [orb418885]
Greater than 90% as determined by SDS-PAGE.
32.5 kDa
E.coli
20 μg, 100 μg, 1 mg K99 fimbrial Protein, E. coli, Recombinant (His & SUMO) [orb1979271]
98.00%
32.5 kDa (predicted)
100 μg, 20 μg, 1 mg
