You have no items in your shopping cart.
Cart summary
K99 fimbrial Protein, E. coli, Recombinant (His & SUMO)
Catalog Number: orb1979271
| Catalog Number | orb1979271 |
|---|---|
| Category | Proteins |
| Description | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae. K99 fimbrial Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.5 kDa and the accession number is P18103. |
| Tag | N-6xHis-SUMO |
| Purity | 98.00% |
| MW | 32.5 kDa (predicted) |
| UniProt ID | P18103 |
| Protein Sequence | NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKPAPGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGNGSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTTSASFLVTYM |
| Expression System | E. coli |
| Biological Origin | E. coli |
| Biological Activity | Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.; FanC is the main component of the K99 fimbriae. K99 fimbrial Protein, E. coli, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 32.5 kDa and the accession number is P18103. |
| Expression Region | 23-181 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
