JOSD1 Rabbit Polyclonal Antibody

SKU: orb587475

Description

Rabbit polyclonal antibody to JOSD1

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human JOSD1
• Target: JOSD1
• Protein Sequence: Synthetic peptide located within the following region: DKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQE
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

dJ508I15.2

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

JOSD1

UniProt

Q15040

RefSeq (Protein):NP_055691