You have no items in your shopping cart.
Jarid2 Rabbit Polyclonal Antibody
SKU: orb329917
Description
Research Area
Cell Biology, Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Canine, Guinea pig, Human, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2 |
| Target | Jarid2 |
| Protein Sequence | Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK |
| Molecular Weight | 137kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti AI317256 antibody, anti AU045941 antibody, anti C79929 antibody, anti C79931 antibody, anti Jmj antibody, anti jumonji antibody
Similar Products
−- Item 1 of 2
JARID2 Rabbit Polyclonal Antibody [orb331001]
WB
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 2
Jarid2 Rabbit Polyclonal Antibody [orb157713]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Sheep
Human, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 50 μl, 100 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
WB Suggested Anti-Jarid2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Mouse Liver.
Documents Download
Datasheet
Product Information
Request a Document
Jarid2 Rabbit Polyclonal Antibody (orb329917)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks