Itsn1 Rabbit Polyclonal Antibody

• Catalog Number: orb576202
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Itsn1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Itsn1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70kDa
• Target: Itsn1
• UniProt ID: Q6NZJ5
• Protein Sequence: Synthetic peptide located within the following region: IPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKK
• NCBI: NP_001103746
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Ese, EHSH, Ese1, Itsn, Sh3p, Ehsh1, Sh3p17, AA5176
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Thymus, Antibody Dilution: 1 ug/ml.