ITIH4 Rabbit Polyclonal Antibody

SKU: orb333853

Description

Rabbit polyclonal antibody to ITIH4

Research Area

Disease Biomarkers

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITIH4
• Target: ITIH4
• Protein Sequence: Synthetic peptide located within the following region: GQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISC
• Molecular Weight: 92 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 35 kDa inter-alpha-trypsin inhibitor heavy chain H4 antibody, anti H4P antibody, anti IHRP antibody, anti Inter-alpha-inhibitor heavy chain 4 antibody, anti Inter-alpha-trypsin inhibitor family heavy chain-related protein antibody, anti Inter-alpha-trypsin inhibitor heavy chain H4 antibody, anti inter-alpha-trypsin inhibitor, heavy chain-like, 1 antibody, anti ITI heavy chain H4 antibody, anti ITI-HC4 antibody, anti ITIH4 antibody, anti ITIH4_HUMAN antibody, anti PK-120 antibody, anti PK120 antibody, anti Plasma kallikrein sensitive glycoprotein 120 antibody

WB Suggested Anti-ITIH4 antibody Titration: 1 ug/ml, Sample Type: Human 293T Whole Cell.

Quick Database Links

Gene Symbol

ITIH4

UniProt

Q14624