You have no items in your shopping cart.
Description
Research Area
Disease Biomarkers
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITIH4 |
| Target | ITIH4 |
| Protein Sequence | Synthetic peptide located within the following region: QEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVE |
| Molecular Weight | 102kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti 35 kDa inter-alpha-trypsin inhibitor heavy chain H4 antibody, anti H4P antibody, anti IHRP antibody, anti Inter-alpha-inhibitor heavy chain 4 antibody, anti Inter-alpha-trypsin inhibitor family heavy chain-related protein antibody, anti Inter-alpha-trypsin inhibitor heavy chain H4 antibody, anti inter-alpha-trypsin inhibitor, heavy chain-like, 1 antibody, anti ITI heavy chain H4 antibody, anti ITI-HC4 antibody, anti ITIH4 antibody, anti ITIH4_HUMAN antibody, anti PK-120 antibody, anti PK120 antibody, anti Plasma kallikrein sensitive glycoprotein 120 antibody
Similar Products
−- Item 1 of 3
- Item 1 of 2
- Item 1 of 2
ITIH4 Rabbit Polyclonal Antibody [orb632870]
ELISA, IHC, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 1
ITIH4 Rabbit Polyclonal Antibody [orb2953262]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg - Item 1 of 2
ITIH4 70k Rabbit Polyclonal Antibody [orb234885]
IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Type: Fetal Lung lysates, Antibody dilution: 1.0 ug/ml.
Documents Download
Datasheet
Product Information
Request a Document
ITIH4 Rabbit Polyclonal Antibody (orb333852)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks