ISYNA1 Rabbit Polyclonal Antibody

• Catalog Number: orb582191
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ISYNA1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ISYNA1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: ISYNA1
• UniProt ID: Q9NPH2
• Protein Sequence: Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
• NCBI: NP_057452
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IPS, INO1, INOS, IPS 1, IPS-1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. ISYNA1 is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-ISYNA1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung.