IRF8 Rabbit Polyclonal Antibody

• Catalog Number: orb573737
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRF8
• Target: IRF8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: QLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDICASHQRSFFRENQQIT
• UniProt ID: Q02556
• MW: 48kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ICSBP, IRF-8, ICSBP1, IMD32A, IMD32B, H-ICSBP
• Note: For research use only
• NCBI: NP_002154

WB Suggested Anti-IRF8 Antibody, Titration: 1.0 ug/ml, Positive Control: THP-1 Whole Cell.