IRF7 Rabbit Polyclonal Antibody

• Catalog Number: orb576666
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRF7
• Target: IRF7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IRF7
• Protein Sequence: Synthetic peptide located within the following region: ISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWP
• UniProt ID: Q92985
• MW: 18kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IMD39, IRF-7, IRF7A, IRF7B, IRF7C, IRF7H, IRF-7H
• Research Area: Epigenetics & Chromatin, Immunology & Inflammation
• Note: For research use only
• NCBI: NP_004022

Application: Western blotting Species+tissue/cell type: HEK293T cells. How many ug’s of tissue/cell lysate run on the gel: 10 ug IRF7 transfected HEK293T lysate, Primary antibody dilution: 1:1000, Secondary antibody: Donkey Anti-rabbit AP, Secondary antibody dilution: 1:2000. IRF7 is supported by BioGPS gene expression data to be expressed in HEK293T.

WB Suggested Anti-IRF7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Hela cell lysate.