IQGAP1 monoclonal antibody (M01), clone 2C5

• Catalog Number: orb2291822
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IQGAP1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 2C5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003861

Detection limit for recombinant GST tagged IQGAP1 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to IQGAP1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]

IQGAP1 monoclonal antibody (M01), clone 2C5 Western Blot analysis of IQGAP1 expression in C32.

Western Blot detection against Immunogen (36.74 KDa).