INVS Rabbit Polyclonal Antibody (FITC)

INVS Rabbit Polyclonal Antibody (FITC) is an FITC conjugated, affinity purified antibody. The immunogen is a synthetic peptide directed towards the following sequence CVLADRLDCADALLKAGADVNKTDHSQRTALHLAAQKGNYRFMKLLLTRR. This antibody is predicted to react with Bovine, Canine, Equine, Human, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer.