INTS11 Rabbit Polyclonal Antibody

• Catalog Number: orb588041
• Category: Antibodies
• Description: Rabbit polyclonal antibody to INTS11
• Target: INTS11
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CPSF3L
• Protein Sequence: Synthetic peptide located within the following region: VMLDCGMHMGFNDDRRFPDFSYITQNGRLTDFLDCVIISHFHLDHCGALP
• UniProt ID: Q5TA45
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RC68, INT11, RC-68, CPSF3L, CPSF73L
• Note: For research use only
• NCBI: NP_001243385.1

Sample Type: Hela Whole cell lysates, Antibody Dilution: 1.0 ug/ml.