You have no items in your shopping cart.
Cart summary
Item 1 of 1
Insect Mexican scorpion Beta-mammal toxin Css4 protein
Catalog Number: orb54172
| Catalog Number | orb54172 |
|---|---|
| Category | Proteins |
| Description | Recombinant insect Mexican scorpion Beta-mammal toxin Css4 protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P60266 |
| MW | 9.6 kDa |
| Application notes | N-terminal 6xHis-tagged: N-terminal 6xHis-tagged21-95AA: 1-66AAFull Length of Mature Protein: Full Length |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Centruroides suffusus suffusus (Mexican scorpion) |
| Expression Region | 20-85aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Css IV |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
