Insect alpha 1 Antitrypsin protein

SKU: orb383389

Description

This Insect alpha 1 Antitrypsin protein spans the amino acid sequence from region 1-174aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged Full Length

Key Properties

• Source: E.coli
• Biological Origin: Tenebrio molitor (Yellow mealworm beetle)
• Tag: N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
• Molecular Weight: 24.7 kDa
• Expression Region: 1-174aa
• Protein Length: Full Length
• Protein Sequence: GLVGAPATLSTAPIAYGGYGGYGAYGGSLLRAAPIARVASPLAYAAPVARVAAPLAYAAPYARAAVAAPVAVAKTVVADEYDPNPQYSFGYDVQDGLTGDSKNQVESRSGDVVQGSYSLVDPDGTRRTVEYTADPINGFNAVVHREPLVAKAVVAAPAIAKVHAPLAYSGGYLH
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

anti A1Aprotein, anti A1ATprotein, anti AATprotein, anti Alpha 1 antitrypsinprotein, anti Alpha1ATprotein, anti Dom1protein, anti PI1protein, anti PRO2275protein, anti Serpin A1protein, anti Serpin A1aprotein, anti Serpina1protein, anti Short peptide from AATprotein, anti SPAATprotein, anti Spi1-1protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P80681