INKA2 Rabbit Polyclonal Antibody

SKU: orb583722

Description

Rabbit polyclonal antibody to INKA2

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Guinea pig

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf183
• Target: INKA2
• Protein Sequence: Synthetic peptide located within the following region: GDNVFADLVGNWLDLPELEKGGEKGETGGAREPKGEKGQPQELGRRFALT
• Molecular Weight: 31kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FAM212B, C1orf183

WB Suggested Anti-C1orf183 Antibody Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Quick Database Links

Gene Symbol

INKA2

UniProt

Q9NTI7

RefSeq (Protein):NP_945120