You have no items in your shopping cart.
Cart summary
Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His)
Catalog Number: orb1977563
| Catalog Number | orb1977563 |
|---|---|
| Category | Proteins |
| Description | Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is Q9IQ47. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | RREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNGYIEGKLS |
| UniProt ID | Q9IQ47 |
| MW | 18.6 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | H3N2 |
| Biological Activity | Influenza A H3N2 (strain A/X-31) Polymerase acidic Protein (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is Q9IQ47. |
| Expression Region | 124-247 aa |
| Storage | -20°C |
| Note | For research use only |
