IL26 Rabbit Polyclonal Antibody

SKU: orb586073

Description

IL26 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting IL26. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Canine. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: IL26
• Protein Sequence: Synthetic peptide located within the following region: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK
• Molecular Weight: 20 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AK155, IL-26

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human ACHN Whole Cell, Antibody dilution: 5 ug/ml.

Sample Tissue: Human HCT116 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

WB Suggested Anti-IL26 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.

Quick Database Links

Gene Symbol

IL26

UniProt

Q9NPH9

RefSeq (Protein):NP_060872