Il20rb Rabbit Polyclonal Antibody

SKU: orb584777

Description

Il20rb Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Il20rb. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of Mouse Il20rb. This antibody reacts with Mouse samples and is predicted to react with Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Il20rb
• Target: Il20rb
• Protein Sequence: Synthetic peptide located within the following region: LEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKA
• Molecular Weight: 31kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Il2, Fndc, Fndc6, Gm186, Il20R2, AV228068

Quick Database Links

Gene Symbol

Il20rb

UniProt

E9Q9A6

RefSeq (Protein):NP_001028715