IL1R2 monoclonal antibody (M01), clone 1G12

• Catalog Number: orb2291943
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IL1R2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: IL1R2 (NP_004624, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: HTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
• Tested applications: ELISA, PLA, WB
• Clone Number: 1G12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004624

Detection limit for recombinant GST tagged IL1R2 is approximately 3 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between IL1A and IL1R2. HeLa cells were stained with anti-IL1A rabbit purified polyclonal 1:1200 and anti-IL1R2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).