IL15 Rabbit Polyclonal Antibody

• Catalog Number: orb582820
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL15
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL15
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 13kDa
• Target: IL15
• UniProt ID: P40933
• Protein Sequence: Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
• NCBI: NP_751914
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IL-15
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): A549 Cell Lysate (N03), Negative control (-): U937 Cell Lysate (N31), Antibody concentration: 3 ug/ml.

WB Suggested Anti-IL15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.