IL13RA1 Rabbit Polyclonal Antibody

• Catalog Number: orb585635
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL13RA1
• Target: IL13RA1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of IL13RA1
• Protein Sequence: Synthetic peptide located within the following region: VSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVP
• UniProt ID: P78552
• MW: 47kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NR4, CT19, CD213A1, IL-13Ra
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_001551
• Expiration Date: 12 months from date of receipt.

Sample Type: Lane 1: 60 ug mouse CT26 lysate, Lane 2: 60 ug mouse MC38 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: IL13RA1.

WB Suggested Anti-IL13RA1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal kidney.