IL10RA Rabbit Polyclonal Antibody

SKU: orb579392

Description

IL10RA Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of IL10RA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human IL10RA. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL10RA
• Target: IL10RA
• Protein Sequence: Synthetic peptide located within the following region: GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
• Molecular Weight: 61kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD210, IL10R, CD210a, CDW210A, HIL-10R, IL-10R1

Quick Database Links

Gene Symbol

IL10RA

UniProt

Q13651

RefSeq (Protein):NP_001549