You have no items in your shopping cart.
Cart summary
IL-6 Protein, Sheep, Recombinant (GST)
Catalog Number: orb1976421
| Catalog Number | orb1976421 |
|---|---|
| Category | Proteins |
| Description | IL-6 Protein, Sheep, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 47.5 kDa and the accession number is P29455. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 47.5 kDa (predicted) |
| UniProt ID | P29455 |
| Protein Sequence | GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK |
| Expression System | E. coli |
| Biological Origin | Sheep |
| Biological Activity | IL-6 Protein, Sheep, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 47.5 kDa and the accession number is P29455. |
| Expression Region | 30-208 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
