You have no items in your shopping cart.
Cart summary
IL-21 RECEPTOR antibody
Catalog Number: orb431064
| Catalog Number | orb431064 |
|---|---|
| Category | Antibodies |
| Description | Goat polyclonal antibody to IL-21 RECEPTOR |
| Species/Host | Goat |
| Clonality | Polyclonal |
| Tested applications | ELISA, IHC-P |
| Reactivity | Human |
| Isotype | Polyclonal IgG |
| Immunogen | Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R. |
| Concentration | 1.0mg/ml |
| Form/Appearance | Purified IgG - liquid |
| Purity | Purified |
| Conjugation | Unconjugated |
| Target | IL-21 RECEPTOR |
| Storage | -20°C only (ship +4°C) |
| Buffer/Preservatives | 0.1% Sodium Azide (NaN3) 0.1% Bovine Serum Albumin. Phosphate buffered saline |
| Note | For research use only |
| Application notes | (N-TERMINAL) |
| Expiration Date | 12 months from date of receipt. |
- Item 1 of 4
IL21R Antibody [orb1238905]
ELISA, IF, IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
0.1 mg, 0.02 mg - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars