IL-17A Protein, Rat, Recombinant (His)

• Catalog Number: orb1976601
• Category: Proteins
• Description: IL-17A Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.0 kDa and the accession number is Q61453.
• Tag: N-6xHis
• Purity: 92.00%
• MW: 21.0 kDa (predicted)
• UniProt ID: Q61453
• Protein Sequence: AVLIPQSSVCPNAEANNFLQNVKVNLKVINSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
• Expression System: E. coli
• Biological Origin: Rat
• Biological Activity: IL-17A Protein, Rat, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 21.0 kDa and the accession number is Q61453.
• Expression Region: 18-150 aa
• Storage: -20°C
• Note: For research use only
• Application notes: Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
• Expiration Date: 6 months from date of receipt.