IGSF1 Rabbit Polyclonal Antibody

• Catalog Number: orb578287
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IGSF1
• Target: IGSF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IGSF1
• Protein Sequence: Synthetic peptide located within the following region: LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
• UniProt ID: Q8N6C5
• MW: 27kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CHTE, p120, IGCD1, IGDC1, INHBP, PGSF2
• Research Area: Cell Biology, Disease Biomarkers, Epigenetics & Ch
• Note: For research use only
• NCBI: NP_991402

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

Rabbit Anti-IGSF1 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-IGSF1 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. IGSF1 is supported by BioGPS gene expression data to be expressed in HepG2.