IGFBP3 Antibody

• Catalog Number: orb316573
• Category: Antibodies
• Description: IGFBP3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat ELISA , 0.1-0.5μg/ml, Human, -Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 31674 MW
• UniProt ID: P17936
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Insulin-like growth factor-binding protein 3;IBP-3
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of IGFBP-3 using anti-IGFBP-3 antibody.Lane 1:rat heart tissue;2:rat brain tissue;3:rat liver tissue;4:rat PC-12 cell.5:human U-87MG cell.6:mouse kidney tissue;7:mouse heart tissue;8:mouse brain tissue.

IHC analysis of IGFBP3 using anti-IGFBP3 antibody.IGFBP3 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.