Igf2bp3 Rabbit Polyclonal Antibody

SKU: orb324884

Description

Rabbit polyclonal antibody to Igf2bp3

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Igf2bp3
• Protein Sequence: Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI
• Molecular Weight: 63kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2610101N11Rik antibody, anti AA522010 antibody, anti AL022933 antibody, anti AU045931 antibody, anti IMP-3 antibody, anti IMP3 antibody, anti Koc13 antibody, anti MGC61294 antibody, anti Neilsen antibody, anti mimp3 antibody

WB Suggested Anti-Igf2bp3 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: Mouse Kidney.

Quick Database Links

Gene Symbol

Igf2bp3

UniProt

Q9CPN8

RefSeq (Protein):NP_076159