IFT74 Rabbit Polyclonal Antibody

SKU: orb331164

Description

IFT74 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting IFT74. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: IFT74
• Protein Sequence: Synthetic peptide located within the following region: WQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTS
• Molecular Weight: 48kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CCDC2 antibody, anti CMG-1 antibody, anti CMG1 antibody, anti FLJ22621 antibody, anti MGC111562 antibody

Quick Database Links

Gene Symbol

IFT74

UniProt

Q96LB3

RefSeq (Protein):NP_079379