IFNA4 Rabbit Polyclonal Antibody

• Catalog Number: orb584775
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IFNA4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Goat, Porcine, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFNA4
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 21kDa
• Target: IFNA4
• UniProt ID: P05014
• Protein Sequence: Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
• NCBI: NP_066546
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: INFA4, IFN-alpha4a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-IFNA4 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Stomach.