You have no items in your shopping cart.
Cart summary
IFNA2 Recombinant Protein (Human)
Catalog Number: orb2053485
| Catalog Number | orb2053485 |
|---|---|
| Category | Proteins |
| Description | IFNA2 Recombinant Protein (Human) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 21.2 kDa |
| UniProt ID | P01563 |
| Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Source | Yeast |
| NCBI | NP_000596 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | alpha-2a interferon;IFNA;IFNA2B;IFN-alpha-2;IFN-al Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human IFNA2 protein (Active) [orb359210]
> 97% as determined by SDS-PAGE and HPLC.
19.2 kDa
Yeast
100 μg, 500 μg - Item 1 of 2
Human IFNA2 protein (Active) [orb359211]
> 96% as determined by SDS-PAGE and HPLC.
19.4 kDa
E.Coli
100 μg, 500 μg - Item 1 of 2
Human IFNA2 protein (Active) [orb359212]
> 98% as determined by SDS-PAGE and HPLC.
19.3 kDa
Yeast
100 μg, 500 μg - Item 1 of 1
Human IFNA2 protein [orb594773]
Greater than 95% as determined by SDS-PAGE.
19.4 kDa
E.coli
10 μg, 500 μg, 1 mg, 50 μg Human IFNA2 protein [orb246107]
Greater than 90% as determined by SDS-PAGE.
21.2 kDa
Yeast
20 μg, 100 μg, 500 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
