You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053483 |
---|---|
Category | Proteins |
Description | IFNA2 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 21.2 kDa |
UniProt ID | P01563 |
Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Source | Yeast |
NCBI | NP_000596 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | alpha-2a interferon;IFNA;IFNA2B;IFN-alpha-2;IFN-al Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
19.2 kDa | |
Yeast |
> 96% as determined by SDS-PAGE and HPLC. | |
19.4 kDa | |
E.Coli |
> 98% as determined by SDS-PAGE and HPLC. | |
19.3 kDa | |
Yeast |
Greater than 95% as determined by SDS-PAGE. | |
19.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
21.2 kDa | |
Yeast |
Filter by Rating