IFIH1 Peptide - middle region

SKU: orb1999582

Description

IFIH1 Peptide - middle region, also known as AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1, is a synthetic peptide designed for use in combination with IFIH1 Rabbit Polyclonal Antibody (orb575984). It corresponds to the sequence PYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIV and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Infectious Disease & Virology

Images & Validation

• Application Notes:
  This is a synthetic peptide designed for use in combination with IFIH1 Rabbit Polyclonal Antibody (orb575984). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: Synthetic peptide located within the following region: PYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIV

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1

Quick Database Links

UniProt

Q9BYX4

RefSeq (Protein):NP_071451