You have no items in your shopping cart.
Cart summary
IFIH1 Peptide - middle region
Catalog Number: orb1999582
| Catalog Number | orb1999582 |
|---|---|
| Category | Proteins |
| Description | IFIH1 Peptide - middle region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: PYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIV |
| UniProt ID | Q9BYX4 |
| MW | 112 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with IFIH1 Rabbit Polyclonal Antibody (orb575984). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1 |
| Note | For research use only |
| NCBI | NP_071451 |
