You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977185 |
---|---|
Category | Proteins |
Description | IFI204 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P0DOV2. |
Tag | C-6xHis |
Purity | 98.00% |
Protein Sequence | QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN |
UniProt ID | P0DOV2 |
MW | 24.2 kDa (predicted) |
Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Expression System | P. pastoris (Yeast) |
Biological Origin | Mouse |
Biological Activity | IFI204 Protein, Mouse, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 24.2 kDa and the accession number is P0DOV2. |
Expression Region | 216-417 aa |
Storage | -20°C |
Note | For research use only |