IFI16 monoclonal antibody (M03), clone 2E3

• Catalog Number: orb2292748
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IFI16.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E3
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
• NCBI: AAH17059
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged IFI16 is approximately 0.3 ng/ml as a capture antibody.

IFI16 monoclonal antibody (M03), clone 2E3. Western Blot analysis of IFI16 expression in Jurkat.

Immunofluorescence of monoclonal antibody to IFI16 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Western Blot analysis of IFI16 expression in transfected 293T cell line by IFI16 monoclonal antibody (M03), clone 2E3. Lane 1: IFI16 transfected lysate (82 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).