IDH2 monoclonal antibody (M01), clone 5F11

• Catalog Number: orb2292750
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IDH2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: IDH2 (NP_002159, 354 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 5F11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_002159

Detection limit for recombinant GST tagged IDH2 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody (M01), clone 5F11. Lane 1: IDH2 transfected lysate (50.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.52 KDa).